Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7JGN5

Expression Region

1-72

Origin

Bacillus cereus (strain AH820)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ESRRB shRNA (UAS) - Lentiviral human ESRRB shRNA (UAS, RFP) plasmid
GTR15306832 1 Vial

Lentiviral human ESRRB shRNA (UAS) - Lentiviral human ESRRB shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DDI1 (NM_001001711) Human Untagged Clone
SC300294 10 µg

DDI1 (NM_001001711) Human Untagged Clone

Sign In for Pricing
View Details
VCAM1 ORF Vector (Human) (pORF)
ORF011427 1.0 µg DNA

VCAM1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SPNS2, NT (SPNS2, Protein spinster homolog 2) (APC) discontinued
042245-APC 200 µL

SPNS2, NT (SPNS2, Protein spinster homolog 2) (APC) discontinued

Sign In for Pricing
View Details
MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated
bs-7920R-Cy3-01 20 µL

MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated
bs-7920R-Cy3-02 100 µL

MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details