Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter sp. ATP synthase subunit c (atpE)

This Recombinant Silicibacter sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-74.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1GDE1

Expression Region

1-74

Origin

Silicibacter sp. (strain TM1040)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGDLAYIGAGLAGMGTGIAALGVGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALG IFSFLVALLLMFAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Free Fatty Acids (NEFA/FFA) Colorimetric Assay Kit
E-BC-K792-M-01 48 T (44 samples)

Free Fatty Acids (NEFA/FFA) Colorimetric Assay Kit

Sign In for Pricing
View Details
Free Fatty Acids (NEFA/FFA) Colorimetric Assay Kit
E-BC-K792-M-02 96 T (92 samples)

Free Fatty Acids (NEFA/FFA) Colorimetric Assay Kit

Sign In for Pricing
View Details
KRT35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A4]
TA811831BM 100 µL

KRT35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A4]

Sign In for Pricing
View Details
ARF1 (NM_001024228) Human Over-expression Lysate
LY422627 100 µg

ARF1 (NM_001024228) Human Over-expression Lysate

Sign In for Pricing
View Details
Heme Oxygenase 1 (HMOX1) (NM_002133) Human Over-expression Lysate
LC400777 20 µg

Heme Oxygenase 1 (HMOX1) (NM_002133) Human Over-expression Lysate

Sign In for Pricing
View Details
7-Benzyloxy-D,L-tryptophan
TRC-B288500-5MG 5 mg

7-Benzyloxy-D,L-tryptophan

Sign In for Pricing
View Details