Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yqzK (yqzK)

This Recombinant Uncharacterized membrane protein yqzK (yqzK) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yqzK

UniProt

C0H451

Expression Region

1-75

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEK GGWFDRLIFFYQNGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX1 (NM_006192) Human Over-expression Lysate
LC432289 20 µg

PAX1 (NM_006192) Human Over-expression Lysate

Sign In for Pricing
View Details
Gibberellin A1
TRC-G377495-25MG 25 mg

Gibberellin A1

Sign In for Pricing
View Details
Fenozolone
TRC-F248840-25MG 25 mg

Fenozolone

Sign In for Pricing
View Details
Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated
PKSH033857-01 20 µg

Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details
Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated
PKSH033857-02 100 µg

Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details
GFI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H7]
TA805546AM 100 µL

GFI1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H7]

Sign In for Pricing
View Details