Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yqzK (yqzK)

This Recombinant Uncharacterized membrane protein yqzK (yqzK) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yqzK

UniProt

C0H451

Expression Region

1-75

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEK GGWFDRLIFFYQNGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Benzylaniline
TRC-B224940-25G 25 g

N-Benzylaniline

Sign In for Pricing
View Details
Diisononyl Phthalate
TRC-D455225-50MG 50 mg

Diisononyl Phthalate

Sign In for Pricing
View Details
NRF1 (NRF1/2609), Biotin conjugate, 0.1mg/mL
BNCB2609-500 1x 500 µL

NRF1 (NRF1/2609), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DACT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13H4]
TA809156AM 100 µL

DACT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13H4]

Sign In for Pricing
View Details
Appl1 Mouse Gene Knockout Kit (CRISPR)
KN501444 1 Kit

Appl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin H (CTSH) (N-term) Rabbit Polyclonal Antibody
AP17259PU-N 400 µL

Cathepsin H (CTSH) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details