Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yqzK (yqzK)

This Recombinant Uncharacterized membrane protein yqzK (yqzK) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yqzK

UniProt

C0H451

Expression Region

1-75

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEK GGWFDRLIFFYQNGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 6 (LHK6), Biotin conjugate, 0.1mg/mL
BNCB0675-100 1x 100 µL

Cytokeratin 6 (LHK6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF647 conjugate, 0.1mg/mL
BNC472624-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS621626 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
MDM2 (SMP14), 0.2mg/mL
BNUB1721-500 1x 500 µL

MDM2 (SMP14), 0.2mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cbfb Mouse Gene Knockout Kit (CRISPR)
KN502594 1 Kit

Cbfb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details