Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides ethenogenes ATP synthase subunit c (atpE)

This Recombinant Dehalococcoides ethenogenes ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3Z8Z7

Expression Region

1-76

Origin

Dehalococcoides ethenogenes (strain 195)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAES IAIFALVISIVLIFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-4- (3-piperidinyloxy) benzonitrile
sc-298348A 1 g

2-Chloro-4- (3-piperidinyloxy) benzonitrile

Sign In for Pricing
View Details
ST7L (Suppressor of Tumorigenicity 7 Protein-like, ST7-Related Protein, ST7L, ST7R) (PE) discontinued
302777-PE 200 µL

ST7L (Suppressor of Tumorigenicity 7 Protein-like, ST7-Related Protein, ST7L, ST7R) (PE) discontinued

Sign In for Pricing
View Details
Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit
MBS093389-01 48 Well

Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit

Sign In for Pricing
View Details
Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit
MBS093389-02 96 Well

Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit

Sign In for Pricing
View Details
Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit
MBS093389-03 5x 96 Well

Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit

Sign In for Pricing
View Details
Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit
MBS093389-04 10x 96 Well

Rat Pituitary Tumor Transforming 1 Interacting Protein ELISA Kit

Sign In for Pricing
View Details