Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine palmitoyltransferase small subunit B (Sptssb)

This Recombinant Mouse Serine palmitoyltransferase small subunit B (Sptssb) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit B, Protein ADMP, Small subunit of serine palmitoyltransferase B, ssSPTb

UniProt

Q925E8

Expression Region

1-76

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLA WEFFSKICGYDSSISN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amivantamab Biosimilar - Research Grade
ICH5222-100mg 100 mg

Amivantamab Biosimilar - Research Grade

Sign In for Pricing
View Details
ADAMTS5 Rabbit Polyclonal Antibody
E53P11503 100 µL

ADAMTS5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYF2
528764-01 100 µL

SYF2

Sign In for Pricing
View Details
SYF2
528764-02 200 µL

SYF2

Sign In for Pricing
View Details
Rat Protein LYRIC (MTDH) ELISA Kit
EK9250 48 Tests

Rat Protein LYRIC (MTDH) ELISA Kit

Sign In for Pricing
View Details
FAM20B Adenovirus (Human)
19941051 1.0 mL

FAM20B Adenovirus (Human)

Sign In for Pricing
View Details