Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine palmitoyltransferase small subunit B (Sptssb)

This Recombinant Mouse Serine palmitoyltransferase small subunit B (Sptssb) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Serine palmitoyltransferase small subunit B, Protein ADMP, Small subunit of serine palmitoyltransferase B, ssSPTb

UniProt

Q925E8

Expression Region

1-76

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLA WEFFSKICGYDSSISN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) KDSA Polyclonal Antibody
MBS7173795 Inquire

Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) KDSA Polyclonal Antibody

Sign In for Pricing
View Details
Akr1c13 AAV siRNA Pooled Vector
11688164 1.0 µg

Akr1c13 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human VGLL1 sgRNA gene knockout kit - Lentiviral human VGLL1 sgRNA gene knockout kit (plasmid)
GTR15390188 1 Vial

Lentiviral human VGLL1 sgRNA gene knockout kit - Lentiviral human VGLL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PIK3AP1 siRNA (Mouse)
MBS8228626-01 15 nmol

PIK3AP1 siRNA (Mouse)

Sign In for Pricing
View Details
PIK3AP1 siRNA (Mouse)
MBS8228626-02 30 nmol

PIK3AP1 siRNA (Mouse)

Sign In for Pricing
View Details
PIK3AP1 siRNA (Mouse)
MBS8228626-03 5x 30 nmol

PIK3AP1 siRNA (Mouse)

Sign In for Pricing
View Details