Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1578 (AF_1578)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1578 (AF_1578) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1578

UniProt

O28694

Expression Region

1-77

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFLIISVPFGIYSLVIYNLTRRAPGKMRYLIPPLLTATLPALYLPLTGFKVSYDLLPVV GYLTYSQFLLLLLQLQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF286 (ZNF286A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]
TA803404AM 100 µL

ZNF286 (ZNF286A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]

Sign In for Pricing
View Details
MTEP Hydrochloride
TRC-M759900-50MG 50 mg

MTEP Hydrochloride

Sign In for Pricing
View Details
PON1 Antibody
KC-23568-01 50 μL

PON1 Antibody

Sign In for Pricing
View Details
PON1 Antibody
KC-23568-02 100 µL

PON1 Antibody

Sign In for Pricing
View Details
PON1 Antibody
KC-23568-03 1 mL

PON1 Antibody

Sign In for Pricing
View Details
Azetirelin (~85%)
TRC-A817605-5MG 5 mg

Azetirelin (~85%)

Sign In for Pricing
View Details