Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1578 (AF_1578)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1578 (AF_1578) spans the amino acid sequence from region 1-77.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1578

UniProt

O28694

Expression Region

1-77

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFLIISVPFGIYSLVIYNLTRRAPGKMRYLIPPLLTATLPALYLPLTGFKVSYDLLPVV GYLTYSQFLLLLLQLQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein A II Recombinant Rabbit Monoclonal Antibody [JB70-35]
ET7107-47 100 µL

Apolipoprotein A II Recombinant Rabbit Monoclonal Antibody [JB70-35]

Sign In for Pricing
View Details
ROCK2 Human Gene Knockout Kit (CRISPR)
KN217764 1 Kit

ROCK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), 0.2mg/mL
BNUB0502-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant HOXB4 Antibody
RC-3044-01 50 μL

Recombinant HOXB4 Antibody

Sign In for Pricing
View Details
Recombinant HOXB4 Antibody
RC-3044-02 100 µL

Recombinant HOXB4 Antibody

Sign In for Pricing
View Details
Recombinant HOXB4 Antibody
RC-3044-03 1 mL

Recombinant HOXB4 Antibody

Sign In for Pricing
View Details