Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative permease-like protein ydzE (ydzE)

This Recombinant Bacillus subtilis Putative permease-like protein ydzE (ydzE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Putative permease-like protein ydzE

UniProt

O31493

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLGIVSTACAFLLWNHGLQLLNASSGGLFFFFQPLVGTLLGWILLGEQIGGTFWIGSFL ILSGVLLVIKEKEKEVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SCLT1 activation kit by CRISPRa
GA115173 1 Kit

Human SCLT1 activation kit by CRISPRa

Sign In for Pricing
View Details
GRIA1 (831-835) Rabbit Polyclonal Antibody
AP26074PU-N 100 µL

GRIA1 (831-835) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CCL23/MPIF-1, Tag Free
HA210894-01 20 µg

Human CCL23/MPIF-1, Tag Free

Sign In for Pricing
View Details
Human CCL23/MPIF-1, Tag Free
HA210894-02 50 µg

Human CCL23/MPIF-1, Tag Free

Sign In for Pricing
View Details
Human CCL23/MPIF-1, Tag Free
HA210894-03 100 µg

Human CCL23/MPIF-1, Tag Free

Sign In for Pricing
View Details
IQGAP2 Rabbit Monoclonal Antibody [Clone ID: R02-1I7]
TA421929 100 µL

IQGAP2 Rabbit Monoclonal Antibody [Clone ID: R02-1I7]

Sign In for Pricing
View Details