Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative permease-like protein ydzE (ydzE)

This Recombinant Bacillus subtilis Putative permease-like protein ydzE (ydzE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Putative permease-like protein ydzE

UniProt

O31493

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLGIVSTACAFLLWNHGLQLLNASSGGLFFFFQPLVGTLLGWILLGEQIGGTFWIGSFL ILSGVLLVIKEKEKEVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzenesulfinic Acid Sodium Salt
TRC-B120600-25G 25 g

Benzenesulfinic Acid Sodium Salt

Sign In for Pricing
View Details
AMPK alpha 2 Antibody
F50381-0.4ML 0.4 mL

AMPK alpha 2 Antibody

Sign In for Pricing
View Details
CNTNAP5 Human Gene Knockout Kit (CRISPR)
KN421472 1 Kit

CNTNAP5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Vinylsyringol
TRC-V280000-250MG 250 mg

4-Vinylsyringol

Sign In for Pricing
View Details
5-ROX, SE [5-Carboxy-X-rhodamine, succinimidyl ester] *CAS 209734-74-7*
389-AAT 5 mg

5-ROX, SE [5-Carboxy-X-rhodamine, succinimidyl ester] *CAS 209734-74-7*

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-01 50 μL

CMTM6 Antibody

Sign In for Pricing
View Details