Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative permease-like protein ydzE (ydzE)

This Recombinant Bacillus subtilis Putative permease-like protein ydzE (ydzE) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Putative permease-like protein ydzE

UniProt

O31493

Expression Region

1-78

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLGIVSTACAFLLWNHGLQLLNASSGGLFFFFQPLVGTLLGWILLGEQIGGTFWIGSFL ILSGVLLVIKEKEKEVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Decorin (DCN/3523), CF647 conjugate, 0.1mg/mL
BNC473523-100 1x 100 µL

Decorin (DCN/3523), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant beta Catenin Monoclonal Antibody
E-AB-81445-01 50 µL

Recombinant beta Catenin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant beta Catenin Monoclonal Antibody
E-AB-81445-02 100 µL

Recombinant beta Catenin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SGCA Antibody
RC-4040-01 50 μL

Recombinant SGCA Antibody

Sign In for Pricing
View Details
Recombinant SGCA Antibody
RC-4040-02 100 µL

Recombinant SGCA Antibody

Sign In for Pricing
View Details