Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Non-structural protein 7a (7a)

This Recombinant Canine coronavirus Non-structural protein 7a (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural protein 7a, ns7a, 11 kDa protein, Accessory protein 7a, X3 protein

UniProt

Q7T6S7

Expression Region

24-101

Origin

Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLNHSLNLKTVNNVLGVTDTGLKVNCLQLLKPDCLDFNILYRSLAETRLLKVVLRV IFLVLLGFCCHRLLVTLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11FIP5 Antibody, Biotin conjugated
A66945-50UG 50 µg

RAB11FIP5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Osteocrin Rabbit Polyclonal Antibody (APC)
orb992045 100 µL

Osteocrin Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]
TA503606AM 100 µL

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS533920 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
NKD2 siRNA (Human)
CRJ3800-01 15 nmol

NKD2 siRNA (Human)

Sign In for Pricing
View Details
NKD2 siRNA (Human)
CRJ3800-02 30 nmol

NKD2 siRNA (Human)

Sign In for Pricing
View Details