Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Non-structural protein 7a (7a)

This Recombinant Canine coronavirus Non-structural protein 7a (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural protein 7a, ns7a, 11 kDa protein, Accessory protein 7a, X3 protein

UniProt

Q7T6S7

Expression Region

24-101

Origin

Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLNHSLNLKTVNNVLGVTDTGLKVNCLQLLKPDCLDFNILYRSLAETRLLKVVLRV IFLVLLGFCCHRLLVTLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDA Receptor 2B/GluN2B Antibody [K20B17]
C18917-20uL 20 µL

NMDA Receptor 2B/GluN2B Antibody [K20B17]

Sign In for Pricing
View Details
Miz1 (ZBTB17) (NM_003443) Human Tagged ORF Clone Lentiviral Particle
RC216143L1V 200 µL

Miz1 (ZBTB17) (NM_003443) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cleaved-MMP-15 (Y132) Polyclonal Antibody
RA23512-01 50 µL

Cleaved-MMP-15 (Y132) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-MMP-15 (Y132) Polyclonal Antibody
RA23512-02 100 µL

Cleaved-MMP-15 (Y132) Polyclonal Antibody

Sign In for Pricing
View Details
Osteopontin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-0026R-BF350-TR 20 µL

Osteopontin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PPCS-d9
TMIR-0029-01 1 mg

PPCS-d9

Sign In for Pricing
View Details