Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yeiS (yeiS)

This Recombinant Escherichia coli Uncharacterized protein yeiS (yeiS) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein yeiS

UniProt

P64536

Expression Region

1-79

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA YIGFGILSIGMIVYLIFYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gremlin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1475R-BF750-01 20 µL

Gremlin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Gremlin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1475R-BF750-02 100 µL

Gremlin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Anti-TSH McAb (coating)
orb98743 1 mg

Anti-TSH McAb (coating)

Sign In for Pricing
View Details
Human Myosin-XV (MYO15A) ELISA Kit
MBS9715096-01 48 Tests

Human Myosin-XV (MYO15A) ELISA Kit

Sign In for Pricing
View Details
Human Myosin-XV (MYO15A) ELISA Kit
MBS9715096-02 96 Tests

Human Myosin-XV (MYO15A) ELISA Kit

Sign In for Pricing
View Details
Human Myosin-XV (MYO15A) ELISA Kit
MBS9715096-03 5x 96 Tests

Human Myosin-XV (MYO15A) ELISA Kit

Sign In for Pricing
View Details