Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae ATP synthase subunit c (atpE)

This Recombinant Salmonella arizonae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A9MJR4

Expression Region

1-79

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL20 Receptor alpha (IL20RA) Mouse Monoclonal Antibody [Clone ID: OTI1B12]
CF811648 100 µg

IL20 Receptor alpha (IL20RA) Mouse Monoclonal Antibody [Clone ID: OTI1B12]

Sign In for Pricing
View Details
Tbc1d10a Mouse Gene Knockout Kit (CRISPR)
KN517234 1 Kit

Tbc1d10a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703912 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CDH18 (NM_004934) Human Over-expression Lysate
LY401535 100 µg

CDH18 (NM_004934) Human Over-expression Lysate

Sign In for Pricing
View Details
Freeze Dryer BFFT-302-A
BFFT-302-A 1 Unit

Freeze Dryer BFFT-302-A

Sign In for Pricing
View Details
(R)-3-Hydroxy Myristic Acid
TRC-H948505-10MG 10 mg

(R)-3-Hydroxy Myristic Acid

Sign In for Pricing
View Details