Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae ATP synthase subunit c (atpE)

This Recombinant Salmonella arizonae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A9MJR4

Expression Region

1-79

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SnoN (SKIL) (NM_001145097) Human Over-expression Lysate
LC428686 20 µg

SnoN (SKIL) (NM_001145097) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody
AP06197PU-N 100 µg

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-Alanine-3,3,3-d3
TRC-A480998-50MG 50 mg

D-Alanine-3,3,3-d3

Sign In for Pricing
View Details
Allyl Acetate-d5
TRC-A549017-25MG 25 mg

Allyl Acetate-d5

Sign In for Pricing
View Details
Polystyrene Wang NPC
H40050.25G 25 g

Polystyrene Wang NPC

Sign In for Pricing
View Details
Ultrasonic Homogenizer BLIH-310
BLIH-310 1 Unit

Ultrasonic Homogenizer BLIH-310

Sign In for Pricing
View Details