Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae ATP synthase subunit c (atpE)

This Recombinant Salmonella arizonae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A9MJR4

Expression Region

1-79

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acrylonitrile-2-d1
TRC-A191383-10MG 10 mg

Acrylonitrile-2-d1

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR560031 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
Desmoplakin (DSP) Human Gene Knockout Kit (CRISPR)
KN218822RB 1 Kit

Desmoplakin (DSP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIMM44 Rabbit Monoclonal Antibody [Clone ID: R04-7H8]
TA421426 100 µL

TIMM44 Rabbit Monoclonal Antibody [Clone ID: R04-7H8]

Sign In for Pricing
View Details
CD79a (JCB117), CF640R conjugate, 0.1mg/mL
BNC400476-500 1x 500 µL

CD79a (JCB117), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isosteviol Acyl-Beta-D-glucuronide Potassium Salt
TRC-I902218-1MG 1 mg

Isosteviol Acyl-Beta-D-glucuronide Potassium Salt

Sign In for Pricing
View Details