Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella agona ATP synthase subunit c (atpE)

This Recombinant Salmonella agona ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5EZ01

Expression Region

1-79

Origin

Salmonella agona (strain SL483)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AhR (Ab-36) Antibody
8B0765-AAT 50 µg

AhR (Ab-36) Antibody

Sign In for Pricing
View Details
HDGF Recombinant Rabbit Monoclonal Antibody [JE56-90]
HA720013 100 µL

HDGF Recombinant Rabbit Monoclonal Antibody [JE56-90]

Sign In for Pricing
View Details
Recombinant TYRO3 Antibody
RC-16448-01 50 μL

Recombinant TYRO3 Antibody

Sign In for Pricing
View Details
Recombinant TYRO3 Antibody
RC-16448-02 100 µL

Recombinant TYRO3 Antibody

Sign In for Pricing
View Details
Recombinant TYRO3 Antibody
RC-16448-03 1 mL

Recombinant TYRO3 Antibody

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF488A conjugate, 0.1mg/mL
BNC881670-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details