Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1IE29

Expression Region

1-79

Origin

Clostridium botulinum (strain Okra / Type B1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NSUN5 shRNA Plasmid
abx960838-01 150 µg

Human NSUN5 shRNA Plasmid

Sign In for Pricing
View Details
Human NSUN5 shRNA Plasmid
abx960838-02 300 µg

Human NSUN5 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Arylsulfatase B/ARSB Antibody
NBP1-86270-25ul 25 µL

Rabbit Polyclonal Arylsulfatase B/ARSB Antibody

Sign In for Pricing
View Details
MtRPOL Double Nickase Plasmid (m2)
sc-432059-NIC-2 20 µg

MtRPOL Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Calcitonin receptor Rabbit Polyclonal Antibody (HRP)
orb471361 100 µL

Calcitonin receptor Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MPB-VC-PAB-DM1
orb2944315-01 50 mg

MPB-VC-PAB-DM1

Sign In for Pricing
View Details