Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1IE29

Expression Region

1-79

Origin

Clostridium botulinum (strain Okra / Type B1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Growth hormone (GH) ELISA Kit
CK-bio-18318-01 48 Tests

Sheep Growth hormone (GH) ELISA Kit

Sign In for Pricing
View Details
Sheep Growth hormone (GH) ELISA Kit
CK-bio-18318-02 96 Tests

Sheep Growth hormone (GH) ELISA Kit

Sign In for Pricing
View Details
Sheep Growth hormone (GH) ELISA Kit
CK-bio-18318-03 5x 96 Tests

Sheep Growth hormone (GH) ELISA Kit

Sign In for Pricing
View Details
Sheep Growth hormone (GH) ELISA Kit
CK-bio-18318-04 10x 96 Tests

Sheep Growth hormone (GH) ELISA Kit

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (MaxLight 550)
246271-ML550 100 µL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (MaxLight 550)

Sign In for Pricing
View Details
ARL3 Antibody
GWB-MV680E 50 µg

ARL3 Antibody

Sign In for Pricing
View Details