Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9MUQ0

Expression Region

2-81

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGSTEERPFSDIITSIRYWVIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTEDRQ DIPLITDRFNALEQLNQYTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab9 (RAB9A) Human shRNA Plasmid Kit (Locus ID 9367)
TR309981 1 Kit

Rab9 (RAB9A) Human shRNA Plasmid Kit (Locus ID 9367)

Sign In for Pricing
View Details
Mouse Cryptic Affinity Purified Polyclonal Ab
AF1840 100 µg

Mouse Cryptic Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
PHF6 (PHD Finger Protein 6, BORJ, MGC14797) (PE)
250056-PE 100 µL

PHF6 (PHD Finger Protein 6, BORJ, MGC14797) (PE)

Sign In for Pricing
View Details
ZNF596 Protein Vector (Human) (pPM-C-His)
PV048088 500 ng

ZNF596 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Zfp36l1 (NM_007564) Mouse Tagged ORF Clone
MR205035 10 µg

Zfp36l1 (NM_007564) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Prokr1 ORF Vector (Mouse) (pORF)
ORF054904 1.0 µg DNA

Prokr1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details