Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9MUQ0

Expression Region

2-81

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGSTEERPFSDIITSIRYWVIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTEDRQ DIPLITDRFNALEQLNQYTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL54 Antibody
A28892-50UG 50 µg

MRPL54 Antibody

Sign In for Pricing
View Details
Heparan Sulfate 2-O-sulfotransferase 1, NT (HS2ST1, HS2ST, 2-O-sulfotransferase, 2OST, dJ604K5.2, FLJ11317, KIAA0448, MGC131986) (MaxLight 550) discontinued
H1890-25N-ML550 100 µL

Heparan Sulfate 2-O-sulfotransferase 1, NT (HS2ST1, HS2ST, 2-O-sulfotransferase, 2OST, dJ604K5.2, FLJ11317, KIAA0448, MGC131986) (MaxLight 550) discontinued

Sign In for Pricing
View Details
CRABP2 (Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-Binding Protein II, CRABPII, CRABP II, CRABP 2) discontinued
311975 100 µL

CRABP2 (Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-Binding Protein II, CRABPII, CRABP II, CRABP 2) discontinued

Sign In for Pricing
View Details
CUL5 Rabbit Polyclonal Antibody (HRP)
orb2133900 100 µL

CUL5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
INPPL1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-7048R-APC-Cy5.5 100 µL

INPPL1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
HEMK1 (NM_016173) Human Tagged ORF Clone
RC200039 10 µg

HEMK1 (NM_016173) Human Tagged ORF Clone

Sign In for Pricing
View Details