Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b559 subunit alpha (psbE)

This Recombinant Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9MUQ0

Expression Region

2-81

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGSTEERPFSDIITSIRYWVIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTEDRQ DIPLITDRFNALEQLNQYTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC8 Goat Polyclonal Antibody
TA305896 100 µg

SIGLEC8 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Dioclea grandiflora (DGL) (Gold, 20nm)
D3714-25G3 1 mL

Dioclea grandiflora (DGL) (Gold, 20nm)

Sign In for Pricing
View Details
KOR-1 (Phospho-Ser369) Colorimetric Cell-Based ELISA Kit
MBS9518819-01 1 Kit

KOR-1 (Phospho-Ser369) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
KOR-1 (Phospho-Ser369) Colorimetric Cell-Based ELISA Kit
MBS9518819-02 5x 1 Kit

KOR-1 (Phospho-Ser369) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Human Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit
abx504231 96 Tests

Human Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit

Sign In for Pricing
View Details
Ethyl 2-butyl-1,3-benzoxazole-6-carboxylate
OR110797 1 Each

Ethyl 2-butyl-1,3-benzoxazole-6-carboxylate

Sign In for Pricing
View Details