Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium bovis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1KI93

Expression Region

1-81

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp874b antibody - middle region (ARP51663_P050)
ARP51663_P050 100 µL

Zfp874b antibody - middle region (ARP51663_P050)

Sign In for Pricing
View Details
MEF2A Antibody
MBS8512401-01 0.05 mg

MEF2A Antibody

Sign In for Pricing
View Details
MEF2A Antibody
MBS8512401-02 0.1 mg

MEF2A Antibody

Sign In for Pricing
View Details
MEF2A Antibody
MBS8512401-03 0.1 mL (AF750)

MEF2A Antibody

Sign In for Pricing
View Details
MEF2A Antibody
MBS8512401-04 0.1 mL (AF405M)

MEF2A Antibody

Sign In for Pricing
View Details
MEF2A Antibody
MBS8512401-05 0.1 mL (AF546)

MEF2A Antibody

Sign In for Pricing
View Details