Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium bovis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1KI93

Expression Region

1-81

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCN3 Protein Vector (Mouse) (pPB-N-His)
PV243927 500 ng

UCN3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CnvK Photo Cross Linker 1 umol scale
26-6539-01 1 Each

CnvK Photo Cross Linker 1 umol scale

Sign In for Pricing
View Details
Recombinant Human ARHGAP27 Protein
E30P65863A 50 µg

Recombinant Human ARHGAP27 Protein

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-01 48 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-02 96 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-03 5x 96 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details