Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Platanus occidentalis ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Platanus occidentalis ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q09G59

Expression Region

1-81

Origin

Platanus occidentalis (Sycamore) (American plane tree)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A31 (ADP/ATP Translocase 4, ADP,ATP Carrier Protein 4, Adenine Nucleotide Translocator 4, ANT 4, Solute Carrier Family 25 Member 31, Sperm Flagellar Energy Carrier Protein, AAC4, ANT4, SFEC) (PE)
MBS6394299-01 0.1 mL

SLC25A31 (ADP/ATP Translocase 4, ADP,ATP Carrier Protein 4, Adenine Nucleotide Translocator 4, ANT 4, Solute Carrier Family 25 Member 31, Sperm Flagellar Energy Carrier Protein, AAC4, ANT4, SFEC) (PE)

Sign In for Pricing
View Details
SLC25A31 (ADP/ATP Translocase 4, ADP,ATP Carrier Protein 4, Adenine Nucleotide Translocator 4, ANT 4, Solute Carrier Family 25 Member 31, Sperm Flagellar Energy Carrier Protein, AAC4, ANT4, SFEC) (PE)
MBS6394299-02 5x 0.1 mL

SLC25A31 (ADP/ATP Translocase 4, ADP,ATP Carrier Protein 4, Adenine Nucleotide Translocator 4, ANT 4, Solute Carrier Family 25 Member 31, Sperm Flagellar Energy Carrier Protein, AAC4, ANT4, SFEC) (PE)

Sign In for Pricing
View Details
CD95/FAS Rabbit Polyclonal Antibody (PerCP)
orb1586347 100 µL

CD95/FAS Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Mouse Monoclonal Alpha Actinin 4 Antibody (93) [DyLight 550]
NBP3-08415R 100 µL

Mouse Monoclonal Alpha Actinin 4 Antibody (93) [DyLight 550]

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Maf-like protein Reut_A2269 (Reut_A2269)
MBS1477439-01 0.02 mg (E-Coli)

Recombinant Cupriavidus pinatubonensis Maf-like protein Reut_A2269 (Reut_A2269)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Maf-like protein Reut_A2269 (Reut_A2269)
MBS1477439-02 0.1 mg (E-Coli)

Recombinant Cupriavidus pinatubonensis Maf-like protein Reut_A2269 (Reut_A2269)

Sign In for Pricing
View Details