Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q318T7

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)
TRV-0061024-01 20 µL

Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)

Sign In for Pricing
View Details
Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)
TRV-0061024-02 100 µL

Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)

Sign In for Pricing
View Details
Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)
TRV-0061024-03 200 µL

Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)

Sign In for Pricing
View Details
Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)
TRV-0061024-04 1 mL

Monoclonal Antibody to Cytochrome P450 1A2 (CYP1A2)

Sign In for Pricing
View Details
ATG9A Human Knockdown Lysate
LY300060 100 µg

ATG9A Human Knockdown Lysate

Sign In for Pricing
View Details
YARS2 CRISPR Knock Out 293T Cell Line (Human)
50588141 1x 10^6 Cells / 1.0 mL

YARS2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details