Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4FGF0

Expression Region

1-81

Origin

Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Endoribonuclease Dicer
E0156b 96 Tests

ELISA Kit For Endoribonuclease Dicer

Sign In for Pricing
View Details
ITGBL1 Protein (C-His, Human)
P505281 100 µg

ITGBL1 Protein (C-His, Human)

Sign In for Pricing
View Details
Ggnbp2 Double Nickase Plasmid (m)
sc-432161-NIC 20 µg

Ggnbp2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
OLIG3 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62456R-APC-Cy5.5 100 µL

OLIG3 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Growth Arrest Specific 2 (Growth Arrest-specific Protein 2, GAS2, GAS-2, MGC32610) (FITC)
127566-FITC 100 µL

Growth Arrest Specific 2 (Growth Arrest-specific Protein 2, GAS2, GAS-2, MGC32610) (FITC)

Sign In for Pricing
View Details
AMID (AIFM2) Human shRNA Plasmid Kit (Locus ID 84883)
TL306733 1 Kit

AMID (AIFM2) Human shRNA Plasmid Kit (Locus ID 84883)

Sign In for Pricing
View Details