Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE)
This Recombinant Prochlorococcus marinus Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.
Product Specifications
Product Name Alternative
Cytochrome b559 subunit alpha, PSII reaction center subunit V
UniProt
A2C0D1
Expression Region
1-82
Origin
Prochlorococcus marinus (strain NATL1A)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAGSTGERPFFEIITSVRYWIIHAVALPAIFVAGFLFVSSGLAYDAFGTPRPDTYFQAG ESKAPVVVQRFDSKAELDTRLK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15092421 1 Vial
Lentiviral human RTP4 shRNA (UAS) - Lentiviral human RTP4 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details 
133889 50 µg
ST13 (Hsc70-interacting Protein, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, Suppression of Tumorigenicity 13 Protein, FAM10A1, HIP, SNC6, FLJ27260, MGC129952)
Sign In for Pricing
View Details 