Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heterosigma akashiwo ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Heterosigma akashiwo ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2XT86

Expression Region

1-82

Origin

Heterosigma akashiwo (strain NIES-293)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSIISAASVIAAGLSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFM EALTIYGLVVALSLLFANPFTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Chloro-7-tosyl-7H-pyrrolo[2,3-d]pyrimidine
TRC-C370130-5G 5 g

4-Chloro-7-tosyl-7H-pyrrolo[2,3-d]pyrimidine

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638438 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
(S)-1-Pyridin-2-yl-ethylamine
TRC-P993405-500MG 500 mg

(S)-1-Pyridin-2-yl-ethylamine

Sign In for Pricing
View Details
CDH8 Antibody
8C12106-AAT 50 µg

CDH8 Antibody

Sign In for Pricing
View Details
Human R3HDmL activation kit by CRISPRa
GA115434 1 Kit

Human R3HDmL activation kit by CRISPRa

Sign In for Pricing
View Details