Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heterosigma akashiwo ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Heterosigma akashiwo ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2XT86

Expression Region

1-82

Origin

Heterosigma akashiwo (strain NIES-293)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSIISAASVIAAGLSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFM EALTIYGLVVALSLLFANPFTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS628344 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-3022-01 50 μL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-3022-02 100 µL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-3022-03 1 mL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), CF488A conjugate, 0.1mg/mL
BNC880371-500 1x 500 µL

Cytokeratin, pan (AE-1 / AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene A CHO
HA25031506.100G 100 g

Polystyrene A CHO

Sign In for Pricing
View Details