Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131)

This Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0131

UniProt

Q92JD6

Expression Region

1-82

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIFSPAKFRIIVIGTMLG LSCAYFTYKYIVPIFISLLNGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorine Indicator Strips 0-20mg/L
PAP1228 100 / PCK

Chlorine Indicator Strips 0-20mg/L

Sign In for Pricing
View Details
Lentiviral human FAM126B shRNA (UAS) - Lentiviral human FAM126B shRNA (UAS, GFP) (25)
GTR15347255 1 Vial

Lentiviral human FAM126B shRNA (UAS) - Lentiviral human FAM126B shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
XIRP2 (NM_001079810) Human Tagged ORF Clone Lentiviral Particle
RC219560L4V 200 µL

XIRP2 (NM_001079810) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Proinsulin Rabbit Polyclonal Antibody (APC)
orb995420 100 µL

Proinsulin Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CARHSP1 Human Over-expression Lysate
orb1343969 100 µg

CARHSP1 Human Over-expression Lysate

Sign In for Pricing
View Details
CAST Polyclonal Antibody
E-AB-14814-01 20 µL

CAST Polyclonal Antibody

Sign In for Pricing
View Details