Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131)

This Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0131

UniProt

Q92JD6

Expression Region

1-82

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIFSPAKFRIIVIGTMLG LSCAYFTYKYIVPIFISLLNGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Translocator Protein (TSPO) ELISA Kit
abx516778 96 Tests

Pig Translocator Protein (TSPO) ELISA Kit

Sign In for Pricing
View Details
ZNF763 CRISPR Activation Plasmid (h)
sc-415381-ACT 20 µg

ZNF763 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Klk1b27 (NM_020268) Mouse Untagged Clone
MC208827 10 µg

Klk1b27 (NM_020268) Mouse Untagged Clone

Sign In for Pricing
View Details
ZFP62 Rabbit Polyclonal Antibody (RBITC)
orb1074690 100 µL

ZFP62 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
LANCL2 antibody
70R-2665 100 µL

LANCL2 antibody

Sign In for Pricing
View Details
Human forkhead box O1 (FOXO1) ELISA Kit
QY-E04046 96 Tests

Human forkhead box O1 (FOXO1) ELISA Kit

Sign In for Pricing
View Details