Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131)

This Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0131

UniProt

Q92JD6

Expression Region

1-82

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIFSPAKFRIIVIGTMLG LSCAYFTYKYIVPIFISLLNGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum for PC-3 Cell Culture
C6729F-500ml 500 mL

Serum for PC-3 Cell Culture

Sign In for Pricing
View Details
Diacylglycerol Kinase α (DGKA) Porcine ELISA Kit
C8853 96 Tests

Diacylglycerol Kinase α (DGKA) Porcine ELISA Kit

Sign In for Pricing
View Details
Atp5s (NM_026536) Mouse Tagged ORF Clone
MR202039 10 µg

Atp5s (NM_026536) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ddx41 (NM_134059) Mouse Recombinant Protein
E45M45467M5 20 µg

Ddx41 (NM_134059) Mouse Recombinant Protein

Sign In for Pricing
View Details
GENLISA™ Porcine Macrophage Migration Inhibitory Factor (MIF) ELISA
KLP0733 1x 96 Well

GENLISA™ Porcine Macrophage Migration Inhibitory Factor (MIF) ELISA

Sign In for Pricing
View Details
IRF1 Antibody
orb3160132-01 50 µL

IRF1 Antibody

Sign In for Pricing
View Details