Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131)

This Recombinant Rickettsia conorii Uncharacterized protein RC0131 (RC0131) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0131

UniProt

Q92JD6

Expression Region

1-82

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKNLLCIIIFLGINLNVYAINSSSYTTDDIIKIVIILGIVILIFSPAKFRIIVIGTMLG LSCAYFTYKYIVPIFISLLNGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scgb3a2 (NM_054038) Mouse Tagged ORF Clone Lentiviral Particle
MR223576L4V 200 µL

Scgb3a2 (NM_054038) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Benzyl- (4-tert-butyl-benzyl) -amine
sc-326254 500 mg

Benzyl- (4-tert-butyl-benzyl) -amine

Sign In for Pricing
View Details
PPIB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1698605 3x 1.0 µg

PPIB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Spata13 activation kit by CRISPRa
GA213595 1 Kit

Mouse Spata13 activation kit by CRISPRa

Sign In for Pricing
View Details
Murlentamab Biosimilar - Research Grade
ICH5694-20mg 20 mg

Murlentamab Biosimilar - Research Grade

Sign In for Pricing
View Details
Mouse Muscarinic acetylcholine receptor M2 (CHRM2) ELISA Kit
GTR10365132 96 Well

Mouse Muscarinic acetylcholine receptor M2 (CHRM2) ELISA Kit

Sign In for Pricing
View Details