Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q9TM30

Expression Region

1-82

Origin

Cyanidium caldarium

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPIISAASVIAAGLAVGLAAIGPGIGQGSAAANAVEGLARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALSLLFANPFIK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAP Kinase 1 (DAPK1) (NM_004938) Human Untagged Clone
SC323458 10 µg

DAP Kinase 1 (DAPK1) (NM_004938) Human Untagged Clone

Sign In for Pricing
View Details
CENPC (MIF2, hcp-4, CENP-C, CENPC1, Centromere Protein C 1) (PE)
MBS6445600-01 0.1 mL

CENPC (MIF2, hcp-4, CENP-C, CENPC1, Centromere Protein C 1) (PE)

Sign In for Pricing
View Details
CENPC (MIF2, hcp-4, CENP-C, CENPC1, Centromere Protein C 1) (PE)
MBS6445600-02 5x 0.1 mL

CENPC (MIF2, hcp-4, CENP-C, CENPC1, Centromere Protein C 1) (PE)

Sign In for Pricing
View Details
EIF2B1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-14535R-PE-Cy7 100 µL

EIF2B1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-548ab Virus
mh6900 1.0 mL

AdmiRa-Off-hsa-miR-548ab Virus

Sign In for Pricing
View Details
Rat Chga Pre-designed siRNA Set A
SI202688A 1 Each

Rat Chga Pre-designed siRNA Set A

Sign In for Pricing
View Details