Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxcA (yxcA)

This Recombinant Bacillus subtilis Uncharacterized protein yxcA (yxcA) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein yxcA

UniProt

P46332

Expression Region

1-83

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLF FYPVHIWMKREFGRWNDTEKKRG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jagged1/CD339 Rabbit Polyclonal Antibody (Cy5.5)
orb1081329 100 µL

Jagged1/CD339 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Human Apelin 13 (AP13) ELISA Kit
orb2984334 96 Tests

Human Apelin 13 (AP13) ELISA Kit

Sign In for Pricing
View Details
Domiphen Bromide
C09993-1g 1 g

Domiphen Bromide

Sign In for Pricing
View Details
FFAR1 Rabbit pAb
A16379 1000 μL

FFAR1 Rabbit pAb

Sign In for Pricing
View Details
Crystal Ponceau 6R (Technical Grade)
TRC-C827490-5G 5 g

Crystal Ponceau 6R (Technical Grade)

Sign In for Pricing
View Details
VEGFD Antibody, FITC conjugated
A42732-100UG 100 µg

VEGFD Antibody, FITC conjugated

Sign In for Pricing
View Details