Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxcA (yxcA)

This Recombinant Bacillus subtilis Uncharacterized protein yxcA (yxcA) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein yxcA

UniProt

P46332

Expression Region

1-83

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLF FYPVHIWMKREFGRWNDTEKKRG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium-Activated Chloride Channel Regulator Family Member 3 (CLCA3P) Antibody
abx030552-01 80 µL

Calcium-Activated Chloride Channel Regulator Family Member 3 (CLCA3P) Antibody

Sign In for Pricing
View Details
Calcium-Activated Chloride Channel Regulator Family Member 3 (CLCA3P) Antibody
abx030552-02 400 µL

Calcium-Activated Chloride Channel Regulator Family Member 3 (CLCA3P) Antibody

Sign In for Pricing
View Details
MAT2B Antibody, FITC conjugated
A69739-50UG 50 µg

MAT2B Antibody, FITC conjugated

Sign In for Pricing
View Details
2-Perfluorooctyl-[1,1-2H2]-[1,2-13C2]-ethanol
T294302 25 mg

2-Perfluorooctyl-[1,1-2H2]-[1,2-13C2]-ethanol

Sign In for Pricing
View Details
PLC gamma 1 antibody
70R-50215 100 ul

PLC gamma 1 antibody

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b UPF0294 protein yafD (yafD)
MBS1425766-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b UPF0294 protein yafD (yafD)

Sign In for Pricing
View Details