Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxcA (yxcA)

This Recombinant Bacillus subtilis Uncharacterized protein yxcA (yxcA) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein yxcA

UniProt

P46332

Expression Region

1-83

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLF FYPVHIWMKREFGRWNDTEKKRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 2 (STX2) Antibody
abx375773 100 µg

Syntaxin 2 (STX2) Antibody

Sign In for Pricing
View Details
Anti-BAGE2 Antibody
MBS9233610-01 0.1 mL

Anti-BAGE2 Antibody

Sign In for Pricing
View Details
Anti-BAGE2 Antibody
MBS9233610-02 5x 0.1 mL

Anti-BAGE2 Antibody

Sign In for Pricing
View Details
R CD59 Expression Lentivirus
LVP643 1x 10^7 IFU/mL - 200 μL

R CD59 Expression Lentivirus

Sign In for Pricing
View Details
Anti-Hu TCR gamma/delta FITC
1F-147-T025 25 Tests

Anti-Hu TCR gamma/delta FITC

Sign In for Pricing
View Details
5-Bromo-2-methylamino-4-picoline
FGA78999-01 0.5 g

5-Bromo-2-methylamino-4-picoline

Sign In for Pricing
View Details