Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)

This Recombinant Bovine Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

Q2KIN1

Expression Region

2-84

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATGTDQVVGLGLVALSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAIAIPLAAGHLL LLFVGIFITYVMLKNQNDTKKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cldn23 Mouse Gene Knockout Kit (CRISPR)
KN503414 1 Kit

Cldn23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrin alpha 3 (ITGA3) Human Gene Knockout Kit (CRISPR)
KN417882 1 Kit

Integrin alpha 3 (ITGA3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NgR3 Recombinant Rabbit Monoclonal Antibody [JE64-44]
HA722362 100 µL

NgR3 Recombinant Rabbit Monoclonal Antibody [JE64-44]

Sign In for Pricing
View Details
Multi-Well Plate
KF22US-9-NS 50 Pack/Case

Multi-Well Plate

Sign In for Pricing
View Details
Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF647 conjugate, 0.1mg/mL
BNC472267-100 1x 100 µL

Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLS3 Polyclonal Antibody
E-AB-11489-01 20 µL

PLS3 Polyclonal Antibody

Sign In for Pricing
View Details