Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)

This Recombinant Bovine Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

Q2KIN1

Expression Region

2-84

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATGTDQVVGLGLVALSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAIAIPLAAGHLL LLFVGIFITYVMLKNQNDTKKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Mouse CLU (Clusterin) ELISA Kit
E-UNEL-M0060-01 5x 96 Tests

Uncoated Mouse CLU (Clusterin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse CLU (Clusterin) ELISA Kit
E-UNEL-M0060-02 15x 96 Tests

Uncoated Mouse CLU (Clusterin) ELISA Kit

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), CF405S conjugate, 0.1mg/mL
BNC040120-100 1x 100 µL

Lung Specific Antigen (LSA120), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LINC02876 activation kit by CRISPRa
GA119305 1 Kit

Human LINC02876 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Acetoxy-2,6-xylidine
TRC-A164480-25MG 25 mg

4-Acetoxy-2,6-xylidine

Sign In for Pricing
View Details
Recombinant Fibulin 5 Antibody
RC-15185-01 50 μL

Recombinant Fibulin 5 Antibody

Sign In for Pricing
View Details