Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)

This Recombinant Bovine Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Dolichol phosphate-mannose biosynthesis regulatory protein

UniProt

Q2KIN1

Expression Region

2-84

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATGTDQVVGLGLVALSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAIAIPLAAGHLL LLFVGIFITYVMLKNQNDTKKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Chromate
TRC-S615260-25G 25 g

Sodium Chromate

Sign In for Pricing
View Details
IR (Ab-1355) Antibody
8B0493-AAT 50 µg

IR (Ab-1355) Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB500881 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
Human SLC16A12 activation kit by CRISPRa
GA117898 1 Kit

Human SLC16A12 activation kit by CRISPRa

Sign In for Pricing
View Details
p57 Kip2 (CDKN1C) Human Gene Knockout Kit (CRISPR)
KN209840 1 Kit

p57 Kip2 (CDKN1C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLCB1 Antibody
KC-3860-01 50 μL

PLCB1 Antibody

Sign In for Pricing
View Details