Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Envelope small membrane protein (E)

This Recombinant Murine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, Non-structural protein NS3

UniProt

P0C2R0

Expression Region

1-83

Origin

Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD RSKQLYKYYNEEMRLPLLEVDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR2B Antibody
ABF6425 100 µg

NMDAR2B Antibody

Sign In for Pricing
View Details
ROR2, Fc-Fusion (IgG1), Avi-Tag, Biotin-Labeled HiP™
100046 50 µg

ROR2, Fc-Fusion (IgG1), Avi-Tag, Biotin-Labeled HiP™

Sign In for Pricing
View Details
1- ([1,1'-Biphenyl]-3-yl) ethanol
OR1092962-01 250 mg

1- ([1,1'-Biphenyl]-3-yl) ethanol

Sign In for Pricing
View Details
1- ([1,1'-Biphenyl]-3-yl) ethanol
OR1092962-02 500 mg

1- ([1,1'-Biphenyl]-3-yl) ethanol

Sign In for Pricing
View Details
1- ([1,1'-Biphenyl]-3-yl) ethanol
OR1092962-03 1 g

1- ([1,1'-Biphenyl]-3-yl) ethanol

Sign In for Pricing
View Details
Monoclonal FYN Antibody, Clone: 2H8
AMM02847G 0.1ml

Monoclonal FYN Antibody, Clone: 2H8

Sign In for Pricing
View Details