Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Envelope small membrane protein (E)

This Recombinant Murine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, Non-structural protein NS3

UniProt

P0C2R0

Expression Region

1-83

Origin

Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD RSKQLYKYYNEEMRLPLLEVDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1303003 3'UTR Lenti-reporter-Luc Vector
38897086 1.0 µg

RGD1303003 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-MKL1 antibody
STJ110802 100 µl

Anti-MKL1 antibody

Sign In for Pricing
View Details
ME2 Antibody
orb43592-01 50 µg

ME2 Antibody

Sign In for Pricing
View Details
ME2 Antibody
orb43592-02 100 µg

ME2 Antibody

Sign In for Pricing
View Details
Human hsa-miR-548aa miRNA Agomir
abx881218-01 5 nmol

Human hsa-miR-548aa miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-548aa miRNA Agomir
abx881218-02 10 nmol

Human hsa-miR-548aa miRNA Agomir

Sign In for Pricing
View Details