Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0A308

Expression Region

1-84

Origin

Vibrio parahaemolyticus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METLLSFSAIAVGIIVGLASLGTAIGFALLGGKFLEGAARQPEMAPMLQVKMFIIAGLLD AVPMIGIVIALLFTFANPFVGQLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC41 (CEP83) Rabbit Polyclonal Antibody
TA374655 100 µL

CCDC41 (CEP83) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505972 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Purified Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093A-01 25 µg

Purified Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
Purified Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093A-02 100 µg

Purified Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
Alanine Transaminase Microplate Assay Kit
RDSM002 100 Assays

Alanine Transaminase Microplate Assay Kit

Sign In for Pricing
View Details
MDM2 Antibody
F42269-0.4ML 0.4 mL

MDM2 Antibody

Sign In for Pricing
View Details