Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0A308

Expression Region

1-84

Origin

Vibrio parahaemolyticus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METLLSFSAIAVGIIVGLASLGTAIGFALLGGKFLEGAARQPEMAPMLQVKMFIIAGLLD AVPMIGIVIALLFTFANPFVGQLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAU Protein Vector (Human) (pPM-C-HA)
PV031607 500 ng

PLAU Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human ERVFRD-1 qPCR Primer Pair
QH77577S 200 Tests

Human ERVFRD-1 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)
MBS1478122-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)
MBS1478122-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)
MBS1478122-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)
MBS1478122-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Serine carboxypeptidase-like 13 (SCPL13)

Sign In for Pricing
View Details