Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5WBA8

Expression Region

1-85

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor polyclonal antibody
orb1678292-01 50 µL

Von Willebrand Factor polyclonal antibody

Sign In for Pricing
View Details
Von Willebrand Factor polyclonal antibody
orb1678292-02 100 µL

Von Willebrand Factor polyclonal antibody

Sign In for Pricing
View Details
Von Willebrand Factor polyclonal antibody
orb1678292-03 200 µL

Von Willebrand Factor polyclonal antibody

Sign In for Pricing
View Details
FAM46D AAV siRNA Pooled Vector
20034161 1.0 µg

FAM46D AAV siRNA Pooled Vector

Sign In for Pricing
View Details
FOXP3 Knockout 786-O Polyclonal Cells
ARG5719 1 Million

FOXP3 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human ING3 sgRNA gene knockout kit - Lentiviral human ING3 sgRNA gene knockout kit (plasmid)
GTR15383558 1 Vial

Lentiviral human ING3 sgRNA gene knockout kit - Lentiviral human ING3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details