Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)

This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3K1F1

Expression Region

1-85

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-2 R beta Antibody (5H4) [Janelia Fluor 549]
NBP3-12040JF549 0.1 mL

Rabbit Monoclonal IL-2 R beta Antibody (5H4) [Janelia Fluor 549]

Sign In for Pricing
View Details
Claudin-14 Antibody (Carrier-free)
orb3165440 100 µg

Claudin-14 Antibody (Carrier-free)

Sign In for Pricing
View Details
Human Heat Shock Protein 60, HSP-60 ELISA Kit
MBS702807-01 24 Well (LIMIT 1)

Human Heat Shock Protein 60, HSP-60 ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 60, HSP-60 ELISA Kit
MBS702807-02 48 Well

Human Heat Shock Protein 60, HSP-60 ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 60, HSP-60 ELISA Kit
MBS702807-03 96 Well

Human Heat Shock Protein 60, HSP-60 ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 60, HSP-60 ELISA Kit
MBS702807-04 5x 96 Well

Human Heat Shock Protein 60, HSP-60 ELISA Kit

Sign In for Pricing
View Details