Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)

This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C3K1F1

Expression Region

1-85

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin III antibody
10R-7434 100 ul

Peroxiredoxin III antibody

Sign In for Pricing
View Details
BDNF Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-52368R-BF405-01 20 µL

BDNF Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
BDNF Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-52368R-BF405-02 100 µL

BDNF Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
MMP25 Polyclonal Antibody
MBS126850-01 0.02 mL

MMP25 Polyclonal Antibody

Sign In for Pricing
View Details
MMP25 Polyclonal Antibody
MBS126850-02 0.1 mL

MMP25 Polyclonal Antibody

Sign In for Pricing
View Details
MMP25 Polyclonal Antibody
MBS126850-03 5x 0.1 mL

MMP25 Polyclonal Antibody

Sign In for Pricing
View Details